View larger
West Nile Virus Pre-M Recombinant ( WNV Pre-M )
DescriptionThe E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.MethodPurified by proprietary chromatographic technique.PurityProtein is >95% pure as
Data sheet
| Formulation | 20mM phosphate buffer pH 7.5. |
| Purity | Protein is >95% pure as determined by SDS-PAGE. |
| Applications | Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. |
| Description | The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. |
| Protein Background | West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins. |
| Expression host | Escherichia Coli. |
| Stability | WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Amino acid sequence | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE. |