SP1 Antibody View larger

SP1 Antibody

ASA-B1764

$330.00

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

Sp1 transcription factor Polyclonal IgG Rabbit Human WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

SP1

Protein

Transcription factor Sp1

Uniprot ID

P08047

Function

Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR- alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component ARNTL/BMAL1.

Tissue Specificity

Up-regulated in adenocarcinomas of the stomach (at protein level). Isoform 3 is ubiquitously expressed at low levels.

Sub-cellular localization

Nucleus. Cytoplasm. Note: Nuclear location is governed by glycosylated/phosphorylated states. Insulin promotes nuclear location, while glucagon favors cytoplasmic location.

Sequence Similarities

Belongs to the Sp1 C2H2-type zinc-finger protein family.

Aliases

SP 1 antibody|SP1 antibody|Sp1 transcription factor antibody|SP1_HUMAN antibody|Specificity protein 1 antibody|Transcription factor Sp1 antibody|TSFP 1 antibody|TSFP1 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml HumanAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti-SP1 antibody, ASA-B1764, Western blotting
All lanes: Anti SP1 (ASA-B1764) at 0.5ug/ml
WB: HELA Whole Cell Lysate at 40ug
Predicted bind size: 81KD
Observed bind size: 81KD

© 2024 Novateinbio.com