SP1 Antibody

Overview

Long Name	Antibody Type	Antibody Isotype	Host	Species Reactivity	Validated Applications	Purification
Sp1 transcription factor	Polyclonal	IgG	Rabbit	Human	WB	Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.

Properties

Form	Lyophilized
Size	100 µg/vial
Contents	Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.
Concentration	Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).
Storage	At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene	SP1
Protein	Transcription factor Sp1
Uniprot ID	P08047
Function	Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR- alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component ARNTL/BMAL1.
Tissue Specificity	Up-regulated in adenocarcinomas of the stomach (at protein level). Isoform 3 is ubiquitously expressed at low levels.
Sub-cellular localization	Nucleus. Cytoplasm. Note: Nuclear location is governed by glycosylated/phosphorylated states. Insulin promotes nuclear location, while glucagon favors cytoplasmic location.
Sequence Similarities	Belongs to the Sp1 C2H2-type zinc-finger protein family.
Aliases	SP 1 antibody|SP1 antibody|Sp1 transcription factor antibody|SP1_HUMAN antibody|Specificity protein 1 antibody|Transcription factor Sp1 antibody|TSFP 1 antibody|TSFP1 antibody

Application Details

Application	Concentration*	Species	Validated Using**
Western blot	0.1-0.5μg/ml	Human	AssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information