More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| NAD(P)H dehydrogenase, quinone 1 | Polyclonal | IgG | Rabbit | Human, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | NQO1 |
Protein | NAD(P)H dehydrogenase [quinone] 1 |
Uniprot ID | P15559 |
Function | The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. |
Tissue Specificity | |
Sub-cellular localization | Cytoplasm. |
Sequence Similarities | Belongs to the NAD(P)H dehydrogenase (quinone) family. |
Aliases | Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody| DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody| NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody| NAD(P) H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody| NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- NQO1 antibody, ASA-B1408, Western blotting
All lanes: Anti NQO1 (ASA-B1408) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: MM231 Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Lane 7: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
All lanes: Anti NQO1 (ASA-B1408) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: MM231 Whole Cell Lysate at 40ug
Lane 6: SW620 Whole Cell Lysate at 40ug
Lane 7: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
