Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
leukemia inhibitory factor receptor alpha | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | LIFR |
Protein | Leukemia inhibitory factor receptor |
Uniprot ID | P42702 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody |