More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| flavin containing monooxygenase 1 | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | WB | Immunogen affinity purified. |
Immunogen | ||||||
| A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. | ||||||
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | FMO1 |
Protein | Dimethylaniline monooxygenase [N-oxide-forming] 1 |
Uniprot ID | Q01740 |
Function | This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines. |
Tissue Specificity | Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine. |
Sub-cellular localization | Microsome membrane. Endoplasmic reticulum membrane. |
Sequence Similarities | Belongs to the FMO family. |
Aliases | Dimethylaniline monooxygenase [N oxide forming] 1 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody|Dimethylaniline oxidase 1 antibody|Fetal hepatic flavin containing monooxygenase 1 antibody|Fetal hepatic flavin-containing monooxygenase 1 antibody|Flavin containing monooxygenase 1 (fetal liver) antibody|Flavin Containing Monooxygenase 1 antibody|FMO 1 antibody|FMO1 antibody|FMO1_HUMAN antibody|OTTHUMP00000033536 antibody|OTTHUMP00000033537 antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- FMO1 antibody, ASA-B0722, Western blotting
All lanes: Anti FMO1 (ASA-B0722) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: Rat Kidney Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
All lanes: Anti FMO1 (ASA-B0722) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: Rat Kidney Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
