| Formulation |
Lyophilized from a (0.2uM) filtered solution containing 20mM PB and 150mM NaCl, pH 7.2. |
| Solubility |
It is recommended to reconstitute the lyophilized SLAMF6 in sterile 1xPBS not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Purity |
Greater than 95.0% as determined by SDS-PAGE. |
| Description |
Recombinant Human SLAM Family Member 6/SLAMF6 is produced HEK cells. The target protein is expressed with sequence (Leu28-Lys225) of Human SLAMF6 fused with a polyhistidine tag at the C-terminus. |
| Protein Background |
SLAM family member 6 (SLAMF6) is a member of the SLAM family of immune cell receptors. SLAMF6 is a unique receptor on T cells which, when triggered potentiates T cell expansion in a CD28-independent manner. SLAMF6 has a high expression on NK-, T-, and B cells. SLAMF6 exhibits homotypic interactions and can connect with adaptor molecules such as SAP to alter immune cell function. |
| Expression host |
HEK 293 cells. |
| Synonyms |
CD352, KALI, KALIb, Ly108, NTB-A, NTBA, Activating NK receptor, SLAM family member 6. |
| Reagent Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Stability |
Lyophilized SLAMF6 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SLAMF6 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| Amino acid sequence |
LMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKVDHHHHHH. |
| Product Description |
Immunoreactive with sera of encephalitis virus infected individuals. |
