More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
| parvin, alpha | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen |
| A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | PARVA |
Protein | Alpha-parvin |
Uniprot ID | Q9NVD7 |
Function | Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development (By similarity). Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. |
Tissue Specificity | Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver. |
Sub-cellular localization | Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line . Note: Constituent of focal adhesions. Associates with the actin cytoskeleton. |
Sequence Similarities | Belongs to the parvin family. |
Aliases | Actopaxin antibody|Alpha parvin antibody|Alpha-parvin antibody|Calponin like integrin linked kinase binding protein antibody|Calponin-like integrin-linked kinase-binding protein antibody|CH ILKBP antibody|CH-ILKBP antibody|FLJ10793 antibody|FLJ12254 antibody|Matrix remodelling associated 2 antibody|Matrix remodelling associated protein 2 antibody|Matrix-remodeling-associated protein 2 antibody|MXRA 2 antibody|MXRA2 antibody|PARV A antibody| PARVA antibody| PARVA_HUMAN antibody |
Application Details
| Application | Concentration* | Species | Validated Using** |
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat | AssaySolutio's ECL kit |
| Immunohistochemistry(Paraffin-embedded Section) | 0.5-1μg/ml | Human | AssaySolutio's IHC/ICC Detection kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Parvin alpha antibody, ASA-B1479, Western blotting
All lanes: Anti Parvin alpha (ASA-B1479) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
Anti- Parvin alpha antibody, ASA-B1479, IHC(P)
IHC(P): Human Mammary Cancer Tissue