Parvin alpha  Antibody View larger

Parvin alpha Antibody

ASA-B1479

$386.90

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

parvin, alpha Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

PARVA

Protein

Alpha-parvin

Uniprot ID

Q9NVD7

Function

Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development (By similarity). Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration.

Tissue Specificity

Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver.

Sub-cellular localization

Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line . Note: Constituent of focal adhesions. Associates with the actin cytoskeleton.

Sequence Similarities

Belongs to the parvin family.

Aliases

Actopaxin antibody|Alpha parvin antibody|Alpha-parvin antibody|Calponin like integrin linked kinase binding protein antibody|Calponin-like integrin-linked kinase-binding protein antibody|CH ILKBP antibody|CH-ILKBP antibody|FLJ10793 antibody|FLJ12254 antibody|Matrix remodelling associated 2 antibody|Matrix remodelling associated protein 2 antibody|Matrix-remodeling-associated protein 2 antibody|MXRA 2 antibody|MXRA2 antibody|PARV A antibody| PARVA antibody| PARVA_HUMAN antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, RatAssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml HumanAssaySolutio's IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Parvin alpha antibody, ASA-B1479, Western blotting
All lanes: Anti Parvin alpha (ASA-B1479) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: SW620 Whole Cell Lysate at 40ug
Lane 4: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 42KD
Observed bind size: 42KD
Anti- Parvin alpha antibody, ASA-B1479, IHC(P)
IHC(P): Human Mammary Cancer Tissue

© 2024 Novateinbio.com