Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | ITGA2B |
Protein | Integrin alpha-Iib |
Uniprot ID | P08514 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | antigen CD41 antibody|BDPLT16 antibody|BDPLT2 antibody|CD41 antibody|CD41B antibody|form 2 antibody|GP2B antibody|GPalpha IIb antibody|GPIIb antibody|GT antibody|GTA antibody|HPA3 antibody|Integrin alpha 2b antibody|Integrin alpha IIb antibody|Integrin alpha-IIb light chain antibody|Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) antibody|ITA2B_HUMAN antibody|ITGA2B antibody| ITGAB antibody|platelet fibrinogen receptor, alpha subunit antibody|platelet glycoprotein IIb of IIb/IIIa complex antibody|Platelet membrane glycoprotein IIb antibody|platelet specific antigen BAK antibody |