Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
IKAROS family zinc finger 1 (Ikaros) | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | IKZF1 |
Protein | DNA-binding protein Ikaros |
Uniprot ID | Q13422 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | CLL associated antigen KW 6 antibody|DNA-binding protein Ikaros antibody|hIk 1 antibody|Hs.54452 antibody|IK1 antibody|Ikaros (zinc finger protein) antibody|IKAROS antibody|IKAROS family zinc finger 1 (Ikaros) antibody|Ikaros family zinc finger protein 1 antibody|Ikzf1 antibody| IKZF1_HUMAN antibody|LYF1 antibody|Lymphoid transcription factor LyF-1 antibody|PRO0758 antibody|Zinc finger protein subfamily 1A 1 (Ikaros) antibody|Zinc finger protein subfamily 1A 1 antibody|Zinc finger protein, subfamily 1A, member 1 antibody|ZNFN1A1 antibody |