Eph receptor B1 Antibody

Overview

Long Name	Antibody Type	Antibody Isotype	Host	Species Reactivity	Validated Applications	Purification
EPH receptor B1	Polyclonal	IgG	Rabbit	Human	IHC-P, WB	Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.

Properties

Form	Lyophilized
Size	100 µg/vial
Contents	Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.
Concentration	Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).
Storage	At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene	EPHB1
Protein	Ephrin type-B receptor 1
Uniprot ID	P54762
Function	Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively.
Tissue Specificity	Preferentially expressed in brain.
Sub-cellular localization	Cell membrane.
Sequence Similarities	Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Aliases	Cek 6 antibody|EK6 antibody|ELK antibody|Elkh antibody|EPH receptor B1 antibody|Eph tyrosine kinase 2 antibody|EPH-like kinase 6 antibody| Ephb1 antibody|EPHB1_HUMAN antibody|Ephrin type B receptor 1 antibody|Ephrin type-B receptor 1 antibody|EPHT2 antibody|HEK 6 antibody| HEK6 antibody|NET antibody|Neuronally-expressed EPH-related tyrosine kinase antibody|soluble EPHB1 variant 1 antibody|Tyrosine protein kinase receptor EPH 2 antibody|Tyrosine-protein kinase receptor EPH-2 antibody

Application Details

Application	Concentration*	Species	Validated Using**
Western blot	0.1-0.5μg/ml	Human	AssaySolutio's ECL kit
Immunohistochemistry(Paraffin-embedded Section)	0.5-1μg/ml	Human	AssaySolutio's IHC/ICC Detection kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information