Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
keratin 1, type II | Polyclonal | IgG | Rabbit | Human, Mouse, Rat | IHC-P, WB | Immunogen affinity purified. |
Immunogen | ||||||
A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids. |
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Gene | KRT1 |
Protein | Keratin, type II cytoskeletal 1 |
Uniprot ID | P04104 |
Function | |
Tissue Specificity | |
Sub-cellular localization | |
Sequence Similarities | |
Aliases | 67 kDa cytokeratin antibody|CK-1 antibody|CK1 antibody|Cytokeratin-1 antibody|Cytokeratin1 antibody|EHK antibody|EHK1 antibody| Epidermolytic hyperkeratosis 1 antibody|EPPK antibody|Hair alpha protein antibody|K1 antibody|K2C1_HUMAN antibody|Keratin antibody| Keratin type II cytoskeletal 1 antibody|Keratin-1 antibody|Keratin1 antibody|KRT 1 antibody|Krt1 antibody|KRT1A antibody|NEPPK antibody|type II cytoskeletal 1 antibody|Type II keratin Kb1 antibody|Type-II keratin Kb1 antibody |