More info
Overview
Long Name | Antibody Type | Antibody Isotype | Host | Species Reactivity | Validated Applications | Purification |
FYN proto-oncogene, Src family tyrosine kinase | Polyclonal | IgG | Rabbit | Human | WB | Immunogen affinity purified. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human Fyn(222-255aa ETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTD), identical to the related mouse and rat sequences. |
Properties
Form | Lyophilized |
Size | 100 µg/vial |
Contents | Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration | Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration). |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene | FYN |
Protein | Tyrosine-protein kinase Fyn |
Uniprot ID | P06241 |
Function | Non-receptor tyrosine-protein kinase that plays a role in many biological processes including regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon guidance. Inactive FYN is phosphorylated on its C-terminal tail within the catalytic domain. Following activation by PKA, the protein subsequently associates with PTK2/FAK1, allowing PTK2/FAK1 phosphorylation, activation and targeting to focal adhesions. Involved in the regulation of cell adhesion and motility through phosphorylation of CTNNB1 (beta-catenin) and CTNND1 (delta- catenin). Regulates cytoskeletal remodeling by phosphorylating several proteins including the actin regulator WAS and the microtubule-associated proteins MAP2 and MAPT. Promotes cell survival by phosphorylating AGAP2/PIKE-A and preventing its apoptotic cleavage. Participates in signal transduction pathways that regulate the integrity of the glomerular slit diaphragm (an essential part of the glomerular filter of the kidney) by phosphorylating several slit diaphragm components including NPHS1, KIRREL and TRPC6. Plays a role in neural processes by phosphorylating DPYSL2, a multifunctional adapter protein within the central nervous system, ARHGAP32, a regulator for Rho family GTPases implicated in various neural functions, and SNCA, a small pre-synaptic protein. Participates in the downstream signaling pathways that lead to T-cell differentiation and proliferation following T-cell receptor (TCR) stimulation. Also participates in negative feedback regulation of TCR signaling through phosphorylation of PAG1, thereby promoting interaction between PAG1 and CSK and recruitment of CSK to lipid rafts. CSK maintains LCK and FYN in an inactive form. Promotes CD28-induced phosphorylation of VAV1. |
Tissue Specificity | Isoform 1 is highly expressed in the brain. Isoform 2 is expressed in cells of hemopoietic lineages, especially T-lymphocytes. |
Sub-cellular localization | Cytoplasm. Nucleus. Cell membrane. Note: Present and active in lipid rafts. Palmitoylation is crucial for proper trafficking. |
Sequence Similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily. |
Aliases | C syn protooncogene antibody|Fyn antibody|FYN oncogene related to SRC FGR YES antibody|FYN_HUMAN antibody|MGC45350 antibody|OKT3 induced calcium influx regulator antibody|P59 FYN antibody|p59-Fyn antibody|Protein tyrosine kinase fyn antibody|Proto oncogene tyrosine protein kinase fyn antibody|Proto-oncogene c-Fyn antibody|Proto-oncogene Syn antibody|Protooncogene Syn antibody|SLK antibody|Src like kinase antibody|Src yes related novel gene antibody|Src-like kinase antibody|Src/yes related novel antibody|Src/yes related novel gene antibody|SYN antibody|Tyrosine kinase p59fyn T antibody|Tyrosine kinase p59fyn(T) antibody|Tyrosine-protein kinase Fyn antibody |
Application Details
Application | Concentration* | Species | Validated Using** |
Western blot | 0.1-0.5μg/ml | Human | AssaySolutio's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- Fyn antibody, ASA-B0741, Western blotting
All lanes: Anti Fyn(ASA-B0741) at 0.5ug/ml
Lane 1: JURKAT Whole Cell Lysate at 40ug
Lane 2: HL-60 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: RAJI Whole Cell Lysate at 40ug
Lane 5: CEM Whole Cell Lysate at 40ug
Predicted bind size: 61KD
Observed bind size: 61KD
Anti- Fyn antibody, ASA-B0741, Western blotting
All lanes: Anti (ASA-B0741) at 0.5ug/ml
WB: Recombinant Human Fyn Protein 0.5ng
Predicted bind size: 39KD
Observed bind size: 39KD