View larger

SLAMF6 Human, HEK

$201.00

Data sheet

Formulation Lyophilized from a (0.2uM) filtered solution containing 20mM PB and 150mM NaCl, pH 7.2.
Solubility It is recommended to reconstitute the lyophilized SLAMF6 in sterile 1xPBS not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Purity Greater than 95.0% as determined by SDS-PAGE.
Description Recombinant Human SLAM Family Member 6/SLAMF6 is produced HEK cells. The target protein is expressed with sequence (Leu28-Lys225) of Human SLAMF6 fused with a polyhistidine tag at the C-terminus.
Protein Background SLAM family member 6 (SLAMF6) is a member of the SLAM family of immune cell receptors. SLAMF6 is a unique receptor on T cells which, when triggered potentiates T cell expansion in a CD28-independent manner. SLAMF6 has a high expression on NK-, T-, and B cells. SLAMF6 exhibits homotypic interactions and can connect with adaptor molecules such as SAP to alter immune cell function.
Expression host HEK 293 cells.
Synonyms CD352, KALI, KALIb, Ly108, NTB-A, NTBA, Activating NK receptor, SLAM family member 6.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Stability Lyophilized SLAMF6 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SLAMF6 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Amino acid sequence LMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKVDHHHHHH.
Product Description Immunoreactive with sera of encephalitis virus infected individuals.

© 2024 Novateinbio.com